PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G10150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 305aa    MW: 31643.4 Da    PI: 8.3419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G10150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.1e-191560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l+ av+++G ++W++I ++++ gR++k+c++rw + 
  LPERR05G10150.1 15 KGSWSPEEDEKLKGAVARHGARNWTAIGEEVP-GRSGKSCRLRWCNQ 60
                     799*****************************.***********985 PP

2Myb_DNA-binding57.23.8e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eEd l+v a++++G++ W+tIar +  gRt++++k++w++
  LPERR05G10150.1  67 RRPFSPEEDALIVAAHAKYGNK-WATIARLLH-GRTDNSVKNHWNS 110
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.18961IPR017930Myb domain
SuperFamilySSF466891.91E-2914108IPR009057Homeodomain-like
SMARTSM007172.7E-151463IPR001005SANT/Myb domain
PfamPF002491.8E-181560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-241668IPR009057Homeodomain-like
CDDcd001675.08E-151759No hitNo description
PROSITE profilePS5129425.48762116IPR017930Myb domain
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002492.9E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2369115IPR009057Homeodomain-like
CDDcd001673.37E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSSWTDREKV AVKMKGSWSP EEDEKLKGAV ARHGARNWTA IGEEVPGRSG KSCRLRWCNQ  60
LSPSVHRRPF SPEEDALIVA AHAKYGNKWA TIARLLHGRT DNSVKNHWNS SLRRSRRKAA  120
AAAAANNNAA PAVSYQSMDL TEEEEDDDRT SDDSVAVAAP PPPPPPTASG QAIAVACVPM  180
TPSPPAQPPA AKRLCVAAPP ADPPTSLSLS PPGGGVVETQ APVAGGGGGG EAGGVSSAAV  240
ASEIARILQD PWLMAMMRQM VAEEVQRHMG MVYSLVASSA AQTGGGAGGV GRNGPDGGRP  300
SNGQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32141156107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1362211e-115AC136221.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077J17, complete sequence.
GenBankAP0149611e-115AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-115CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639574.11e-112PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-50MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D9WFF60.0A0A0D9WFF6_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g28320.11e-112(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.13e-51myb domain protein 77